//=time() ?>
@adollarmore @Fortnums @grub_street Thanks Anne! Much looking forward to first bound copies of Preserving, Potting & Pickling!
We’ve partnered with @OBEYGIANT to honor our heroes. He created “Guts not Glory” to honor the heroes who are serving humanity when it is most challenged. Now, we invite you to use your creativity to honor a hero in your life. Share your creation with #HonorHeroes and tag @Adobe.
Today we’re serving up a little thing called legendarity https://t.co/bd0PIOJ6YD
Here ya go, your first serving of absolute nonsense,
but be warned, there are more horrors to come. 🍞
Time to say Goodnight
Taking the lawful walk on Easter Monday
Billboards serving social sermons in 1984 words
Warlike propaganda telling you to fight from your sofa
Churches closed as religion hides under Facebook pages
The economy sinks and stinks as the middle class drowns
OP SPOILERS
/
/
/
/
/
Hello it’s time for Harper to have a brand new, completely unfounded, unrealistic and entirely self serving one piece theory
Been doodling some of my favorite villagers this weekend! Kody serving looks, Lolly having a think, Sterling having some quiet time, and Deirdre belting her heart out
Unrelated to anything else -- #HappyEaster to everyone who is observing Easter today!
I don't have any holiday-related drawings to show, but here's Three in a big pink sweater! (Previously seen on my Ko-Fi page!)
'fandom cinnamon roll' lol I dunno if this is still a term people use but I like the concept behind it. I think maybe Kat ?? She's not perfect but she's sweet enough and undeserving of the struggles she's put in. I think she's a character easy to sympathize with
this is clearly fu yao serving look chapter I would like to thank my king for blessing us with his incomparable beauty
Kura Samoto 沌 佐本
The ultimate aesthete; an aesthete is "a person who has or affects to have a special appreciation of art and beauty."
Shes basically good for preserving crime scenes because she likes the look of the gore and stuff a little too much.
These two live together, so they're allowed to stand within six feet.
#coronavirus #facemasks #animals #pandemicart #animalswithskullsandfacemasksservingasametaphorforsomething https://t.co/VcRtP1vNhe
Serving Dilf even tho no one asked
Adoptive father of the red panda god Yuka
#oc #originalcharacters #originalart #characterdesign #yaoi #bl #customuniverse #omegaverse
#TEN serving us looks once again🤭💗
#NCT #WAYV #nctfanart #텐 #wayvfanart #kpop #kpopfanart @WayV_official @NCTsmtown
Sometimes you just gotta let it roll off your shoulders lol
Amazingly wicked art by @itsbrdey ! Definitely deserving of a watch!!!
They totally caught Twist's attitude!
Spotify keeps serving me this playlist that's just Motion City Soundtrack, City & Colour and Dashboard Confessional and it feels like
@Fortnums #FANDMAWARDS Congrats to @elisabethluard on the Cookery Writer Shortlist, for work in The Oldie.
Her book Preserving, Potting & Pickling from @grub_street coming later this month.
How exactly can #DP3T privacy-preserving Bluetooth COVID-19 alerts work if identifiable personal data never leaves your device? It's actually not so complicated, and even less so now @ncasenmare has made a fantastic, public domain, comic explaining it: https://t.co/YWYvfMcAQm 1/