# coronavirus facemasks animals pandemicart animalswithskullsandfacemasksservingasametaphorforsomething oc originalcharacters originalart characterdesign yaoi bl customuniverse omegaverse ten nct wayv nctfanart 텐 wayvfanart kpop kpopfanart fandmawards dp3t acnh animalcrossing sciencefiction fantasy angels mutant doctor openwindowsyork2020 amystubbs emilystubbs gailfox janeatkin elliotharrison skyscape btsfanart bts napowrimo
画質 高画質

Sometimes you just gotta let it roll off your shoulders lol

Amazingly wicked art by ! Definitely deserving of a watch!!!

They totally caught Twist's attitude!

31 291
2020-04-10

Spotify keeps serving me this playlist that's just Motion City Soundtrack, City & Colour and Dashboard Confessional and it feels like

0 16
2020-04-09

Congrats to on the Cookery Writer Shortlist, for work in The Oldie.
Her book Preserving, Potting & Pickling from coming later this month.

2 10
2020-04-09

How exactly can privacy-preserving Bluetooth COVID-19 alerts work if identifiable personal data never leaves your device? It's actually not so complicated, and even less so now has made a fantastic, public domain, comic explaining it: https://t.co/YWYvfMcAQm 1/

823 1017
2020-04-09

* serving me a coffee to start the day *
good morning ponies 👋 Coffe? ☕️

16 87
2020-04-09

I love Coco. uwu
Her eyes might be an endless void, but she’s a complete sweetheart~ ❤️

Noticed when she first moved in that she enjoyed observing flowers near my house- went ahead and planted some beside her home. XD

7 14
2020-04-09

Observing Gross Seraphim by Chris Seaman

2 7
2020-04-09

NO in April, but all that art still needs a new home, so look here…DAY TEN.
Find five more York artists deserving your ARTtention at https://t.co/nQQqXBUuaQ

1 3
2020-04-09

Can I offer you another serving of TROLL-APPLE PANCAKES? A new page is up at https://t.co/mO7qrtqKEa

7 35
2020-04-08

From expansive skies, to microscopic shells: your Ruskin a view across the sea toward the Hebrides, has reminded us of Ruskin’s seashells, preserving ‘something like a true image of beautiful things that pass away, or which you must yourself leave.’ https://t.co/yX5bNrfQL7

3 13
2020-04-08

This BTS comeback really serving us good

1 2
2020-04-08

I think they made the "ace trainers" a lot more deserving of their title in Gens 6 and onwards

just fought one of them in the Canalave Gym in Platinum and the fucker had 3 identical lvl 37 Bronzors

2 18
2020-04-08

Can we talk about how Miss Stevie Nicks is 71 serving looks 💖🔥

0 2
2020-04-07

I guess observing new DMs gives me the chance to play my previously unplayed DM-XP created characters lol

This is Reina al-Andalusiyya. Does the Iberian Peninsula exist in FR? No. Do I still like that name enough to give my Hobgoblin Pirate? You bet yer ass.

0 2
2020-04-06

Thank you all for coming to my stream tonight! If anyone is interested in reserving next week's stream slots let me know ^^

It's $25USD for a b&w sketch and $30USD for a colored sketch

(The Megumin sketch was done off stream but I wanted to post it so.. ye)

12 68
2020-04-06

Your prompt for day 6 is some wonderful ekphrasis (writing about art) courtesy of the brilliant ! Read about ekphrasis, the artist, and some serving suggestions for your poem here: https://t.co/5639C7swKW

2 1
2020-04-06