# happyeaster coronavirus facemasks animals pandemicart animalswithskullsandfacemasksservingasametaphorforsomething oc originalcharacters originalart characterdesign yaoi bl customuniverse omegaverse ten nct wayv nctfanart 텐 wayvfanart kpop kpopfanart fandmawards dp3t acnh animalcrossing sciencefiction fantasy angels mutant doctor openwindowsyork2020 amystubbs emilystubbs gailfox janeatkin elliotharrison
画質 高画質

serving you a whole mood this week 💅

55 1869
2020-04-14

OP SPOILERS
/
/
/
/
/
Hello it’s time for Harper to have a brand new, completely unfounded, unrealistic and entirely self serving one piece theory

0 5
2020-04-14

Been doodling some of my favorite villagers this weekend! Kody serving looks, Lolly having a think, Sterling having some quiet time, and Deirdre belting her heart out

0 3
2020-04-13

Unrelated to anything else -- to everyone who is observing Easter today!

I don't have any holiday-related drawings to show, but here's Three in a big pink sweater! (Previously seen on my Ko-Fi page!)

3 9
2020-04-12

'fandom cinnamon roll' lol I dunno if this is still a term people use but I like the concept behind it. I think maybe Kat ?? She's not perfect but she's sweet enough and undeserving of the struggles she's put in. I think she's a character easy to sympathize with

0 0
2020-04-12

this is clearly fu yao serving look chapter I would like to thank my king for blessing us with his incomparable beauty

1 4
2020-04-11

Kura Samoto 沌 佐本
The ultimate aesthete; an aesthete is "a person who has or affects to have a special appreciation of art and beauty."
Shes basically good for preserving crime scenes because she likes the look of the gore and stuff a little too much.

0 1
2020-04-11

Sometimes you just gotta let it roll off your shoulders lol

Amazingly wicked art by ! Definitely deserving of a watch!!!

They totally caught Twist's attitude!

31 291
2020-04-10

Spotify keeps serving me this playlist that's just Motion City Soundtrack, City & Colour and Dashboard Confessional and it feels like

0 16
2020-04-09

Congrats to on the Cookery Writer Shortlist, for work in The Oldie.
Her book Preserving, Potting & Pickling from coming later this month.

2 10
2020-04-09

How exactly can privacy-preserving Bluetooth COVID-19 alerts work if identifiable personal data never leaves your device? It's actually not so complicated, and even less so now has made a fantastic, public domain, comic explaining it: https://t.co/YWYvfMcAQm 1/

823 1017
2020-04-09

* serving me a coffee to start the day *
good morning ponies 👋 Coffe? ☕️

16 87
2020-04-09

I love Coco. uwu
Her eyes might be an endless void, but she’s a complete sweetheart~ ❤️

Noticed when she first moved in that she enjoyed observing flowers near my house- went ahead and planted some beside her home. XD

7 14
2020-04-09

Observing Gross Seraphim by Chris Seaman

2 7
2020-04-09

NO in April, but all that art still needs a new home, so look here…DAY TEN.
Find five more York artists deserving your ARTtention at https://t.co/nQQqXBUuaQ

1 3
2020-04-09

Can I offer you another serving of TROLL-APPLE PANCAKES? A new page is up at https://t.co/mO7qrtqKEa

7 35
2020-04-08